Sign In | Join Free | My dowin.com
dowin.com
Products
Search by Category
Wholesale Marketplace
Home > Environment >

Recycling

Recycling

All Recycling wholesalers & Recycling manufacturers come from members. We doesn't provide Recycling products or service, please contact them directly and verify their companies info carefully.

Total 7549 products from Recycling Manufactures & Suppliers
Cheap White color peptides ACTH(1-39) and Corticotropin,cas 9002-60-2 with prompt delivery for sale

Brand Name:Youngshe

Model Number:High quality

Place of Origin:China

ACTH(1-39) and Corticotropin,cas 9002-60-2,Adrenocorticotropin Name: ACTH(1-39), Corticotropin Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF Purity:98% Appearance: white powder Source: ...

Chengdu YoungShe Chemical Co., Ltd
Site Member

Sichuan

Cheap Plunger,Elemento PS7100 090150-6490 for MITSUBISHI/HYUNDAI 4D34T/4M50T/D4DA/D4D4 Пара плунжерная,Element tłoczący pompy for sale

Brand Name:MITSUBISHI/HYUNDAI

Model Number:090150-6490

Place of Origin:CHINA

China Lutong Parts Plant is a manufacturer specialized in diesel engine parts.The majored products is Head Rotor(VE Pump Parts) Nozzle,Plunger,Delivery Valve and so on.As a elder manufacturer for diesel engine parts,we keep step with the international ...

China-Lutong Parts Plant
Active Member

Fujian

Cheap medium duty 3" rigid orange color PU caster double ball bearing , Rueda, for sale

Brand Name:Raifull Caster

Model Number:RF20R100PU

Place of Origin:Guangdong

Medium duty 5" white PP caster, 125x32mm nylon caster, soft rubber wheels, hard rubber wheels, 5x1/1/4" rubber caster, 4" rubber caster, swivel caster, ball bearing nylon caster, medium duty caster wheel, elastic rubber single wheels, rueda, industrial ...

Raifull Caster Co., Ltd
Site Member

Guangdong

Cheap D8NN7580BB Clutch Release Bearing for Ford NAA 501 600 700 800 900 2000 4000 4cy for sale

Brand Name:JIAHANG CLUTCH

Model Number:D8NN7580BB Clutch Release Bearing for Ford NAA 501 600 700 800 900 2000 4000 4cy

Place of Origin:YanCheng

Release Bearing For Ford New Holland Tractor - 82010859 D8Nn7580Bb Ford New Holland 2000; 2120; 2150; 2300; 230A; 231; 2310; 233; 234; 2600; 2600V; 2610; 2810; 2910; 3000; 3055; 3110; 3120; 3150; 3190; 3230; 3300; 334; 335; 3400; 3430; 3500; 3550; 3600; ...

YanCheng JIAHANG Clutch Co., Ltd.
Site Member

Jiangsu

Cheap Double Wall Gold Paperless Coffee Dripper For Chemex / Hario Carafes for sale

Brand Name:TIME

Model Number:KT-03R

Place of Origin:Anping, Hebei, China

Gold Paperless Cone Coffee Dripper For Chemex , Hario , And Other Carafes 1. Description: Time Gold Paperless Cone Coffee Dripper For Chemex , Hario , And Other Carafes -- works manually with any ground coffee or flavors, offering a delicious taste of a 1...

Anping Time Metal Wire Mesh Products Co.,Ltd.
Verified Supplier

Cheap Hot Sale  Mini Pocket First Aid Kit for sale

Place of Origin:MADE IN CHINA

Brand Name:customer printed

Multi Color Small Mini Pocket First Aid Kit Specification Material PP Types: GK-01003 Shape: Irregular shape Size(mm): 135*100*30 Contents:: Standard contents or customized refills, empty box available. Label: customized print Usage: For around 3-5 person...

Shandong Qibang Resin Co., Ltd
Active Member

Shandong

Cheap Supplies school whiteboard ink marker pen,Non-toxic marker pen for sale

Brand Name:SimpleYoo

Model Number:SY- WM001

Place of Origin:China

Supplies school whiteboard ink marker pen,Non-toxic marker pen Product Description: Pen size: 13.5cm*1cm Ink color: Custom Type: Marker pen,Furniture touch-up marker pen Ink: Black/Blue/Red/Green Place of Origin: Jiangsu,China Logo: Customized Brand name:...

Yancheng SimpleYoo stationery &Gift Co., LTD.
Site Member

Jiangsu

Cheap Gypsum Board Production Line for sale for sale

Brand Name:Xiangyi

Place of Origin:Xiangyi

Gypsum Board Production Line Finished gypsum board Specification Dimension of gypsum board: Thickness: 7mm-22mm width: 1200mm or 1220mm length: 1800mm~3600mm Types of Gypsum Board a) Common paper surface gypsum board b) Fireproof paper surface gypsum ...

Hebei Xiangyi Mechanical Co.,Ltd
Active Member

Liaoning

Cheap MQYM10A CONTAMINATION CLEANER for sale

Brand Name:Goldenlion

Model Number:MQYM10A

Place of Origin:China

MQYM10A contamination cleaner is designed to effectively clean various foreign matters from seedcotton, and with higher capacities lower power consumption. It can be used in both hand-picked and machine-picked with different scale cotton ginning lines. ...

Handan Golden Lion Cotton Machinery Co
Active Member

Hebei

Cheap amusement game machine ride on electric power kids battery powered motorcycle electric kids motor bike ride car for sale for sale

Brand Name:huaqin

Model Number:HM-001

Place of Origin:Made in China

amusement game machine ride on electric power kids battery powered motorcycle electric kids motor bike ride car for sale children electric kids car battery kids games How to play: 1. Start : turn on switch and Control the accelerator with your feet 2. ...

Guangzhou HuaQin Playground Equipment Co.,ltd
Active Member

Guangdong

Cheap QUARTZ WATCH PU STRAP COUPLE WATCH WITH EXQUISITE RELIEF for sale

Brand Name:Seeteng

Model Number:SW001

Place of Origin:FUZHOU,FUJIAN,CHINA

Product Description QUARTZ WATCH PU STRAP COUPLE WATCH WITH EXQUISITE RELIEF Item No: SW001 Case Material: Alloy Case-back: stainless steel Movement: Chinese/Japanese strap material: PU/Leather/alloy MOQ: 1000pcs Packing: a pc in a bubble bag, 200pcs in ...

FUZHOU SEETENG ELECTRONIC.CO.TLD
Site Member

Jiangxi

Cheap Slim pair watches 1010G/L for sale

Place of Origin:CHINA

Brand Name:MABOLO

Model Number:1010G/L

Model 1010G/L slim pair watches, stainless steel case,gents case diameter 41.0mm,lady 36.0mm,3ATM genuine leather strap, suit for Japan VX42/VX82 mov't. Note:All inquiry,please kindly contact us at : tina@mablwatch.com so that we can handle your inquiry ...

MABL CLOCK&WATCH CO.,LTD
Site Member

Hong Kong

Cheap Baling Machine For Used Clothing for sale

Brand Name:SINOBALER

Place of Origin:CHINA

Used clothes is popular in waste recycling. Compressed and packed used clothes are much easier for transportation and storage. Lifting chamber baler, swivel twin lifting chamber baler, baling & bagging machine, or fully automatic baler, you can choose ...

SINOBALER Machinery Company Limited
Active Member

Cheap New Design of Home Decor in 2018 for sale

Brand Name:kingsun

Model Number:WKY170920-10

Place of Origin:China

Details 1.Bright color, color uniformity,resistant to crushing and printable nice. 2.Soft hand feeling. 3.a variety of embroideries. 4.Good Quality:We have strict quality control system .Good reputation in the market. 5.Low MOQ: we can meet your ...

SHIJIAZHUANG KINGSUN TEXTILE IMP. & EXP. CO., LTD
Active Member

Cheap CBE-50L Subcritical Extraction Lab Test Machine Mini Home-use Oil Expeller SS304 for sale

Brand Name:Subcritical

Model Number:CBE-50L

Place of Origin:China

Our pilot solvent extraction equipment is specially designed for mini or small scale natural material extraction researching and testing. It is ideal for qualitative tests at the laboratory. It can be used to extract permium quality precious plant oils, ...

Henan Subcritical Extraction Biological Technology Co., Ltd
Active Member

Cheap Multitest Chemistry and Coagulation Analyzer Yj-3000c for sale

Brand Name:forever

Model Number:YJ-3000C

Place of Origin:Henan

Product Description MULTITEST LABORATORY ANALYZER Features: latest concept and technologyFlow through cell, micro and macro cuvette availableLower energy consuming techniques 4.color touch screen 5.muti-language 6.And more... Technical specifications ...

Henan Forever Medical Co., Ltd.
Active Member

Cheap 80W LED moving head light,led stage light for sale

Place of Origin:China

Brand Name:SHIERGE

1.Power supply: AC110-220V ,50-60Hz 2.Power: 80W 3.Source: 36pcs 1W lamp 4.Strobe: 1-20 times / sec. 5.Color: RGB color mixing system (R8, G16, B12) 6.DMX channels: 12CH 7.Horizontal scan: 540 degrees + Trimmer 8.Vertical Scan: 300 degrees + Trimmer 9....

Shierge Technology Co., Limited
Active Member

Guangdong

Cheap Hot sale good quality SBS80 E312C gear pump pilot pump charge pump for CAT excavator part for sale

Brand Name:Sailfish

Model Number:E312C

Place of Origin:CHINA

Hot sale good quality SBS80 E312C gear pump pilot pump charge pump for CAT excavator part contact imfoemation:

Sailfish Machinery&Equipment co.,ltd
Site Member

Guangdong

Cheap YCS-450 Off Shore Hydraulic Piling Hammers for sale

Place of Origin:China

Brand Name:CFM

YCS Off Shore Hydraulic Piling Hammers CFM hydraulic pile hammer is the result of the hydraulic hammer designing, using and manufacturing experience for more than ten years. It is with simple design and fine design, and the striking energy can be ...

China Forging Machinery Co., Ltd.
Active Member

Jiangsu

Cheap Nickel-based UNS N08020 / alloy 20 / W.Nr 2.4660  bar or pipe for sale

Brand Name:SOGOO

Model Number:UNS N08020

Place of Origin:Jiang su, China

Nickel-based UNS N08020 / alloy 20 / W.Nr 2.4660 bar or pipe UNS N08020 Alloy 20 is a highly alloyed austenitic stainless steel developed primarily for use in the sulfuric acid related processes. Alloy 20 is used is a wide variety of applications from ...

Sogoo Industrial and Trading Co. Ltd
Site Member

Jiangsu

Go to Page
Inquiry Cart 0